DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and ndx-4

DIOPT Version :10

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_493413.1 Gene:ndx-4 / 189639 WormBaseID:WBGene00003581 Length:138 Species:Caenorhabditis elegans


Alignment Length:69 Identity:17/69 - (24%)
Similarity:28/69 - (40%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RQFAAEREVKGIQLIHPVVHKCTNGLVHLLPGDDAYPADPDASNEKIEIDLSVEEFRSKTNAKLH 320
            |:.|.:.|...:|..:| .|..|....|:.||:|.:.|....:.|:..|        :|....:|
 Worm    12 RKLAGKIEFLLLQASYP-PHHWTPPKGHVDPGEDEWQAAIRETKEEANI--------TKEQLTIH 67

  Fly   321 RSEH 324
            ...|
 Worm    68 EDCH 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 NUDIX_AcylCoAdiphos_Nudt19 11..245 CDD:467582
ndx-4NP_493413.1 NUDIX_Ap4A_Nudt2 3..135 CDD:467534 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.