DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and ndx-7

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_491336.2 Gene:ndx-7 / 183413 WormBaseID:WBGene00003584 Length:295 Species:Caenorhabditis elegans


Alignment Length:323 Identity:74/323 - (22%)
Similarity:130/323 - (40%) Gaps:74/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSSSSLILLAKNQVEKSTSCDYNALLLTRTQKSTFMPESSVFPGGVCDASDSSPAWLEHFQRNEF 73
            ||::|:||..|.        ....|:|.|...:.|||.:.||||||.|.:|              
 Worm    11 RSAASIILACKT--------TRRVLMLKRGTTAKFMPNTMVFPGGVVDKTD-------------- 53

  Fly    74 SAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLALRLTAIRETFEELGILLCRDSKSLTSTSDYGA 138
              |||.:                         ..|:.|:||.|||.|:|..::....::.:.   
 Worm    54 --AKLGD-------------------------EFRIAAVRELFEESGVLSTKNGWQTSANNP--- 88

  Fly   139 FYDQFDRAHWQHIVHNNASQFLEL----CKQLDVLPDVWSLHEWSVWRTPSTFKKRFETAFFMTA 199
                 |....:..:.|:.|:|.:|    |..        :|.||..:.||:.:.:||.|.|::..
 Worm    89 -----DMTSLKADIVNDTSKFEQLSGTICAD--------NLIEWDTFITPANYPRRFLTKFYLML 140

  Fly   200 LEQEPRVHIEPNEVKDSAWRSPLDYLQASLRKELWLPPPQFYELSRCLNFSSLDNLRQFAAEREV 264
            ::.||.:.:..:|:.:..|..|.:.:..:...:..|||||.|||:|.......|...::.   .|
 Worm   141 VDDEPAIDLCTSEMSEYNWIEPKECVDEAYAGKYALPPPQVYELTRLSQVKDWDLCEKYG---NV 202

  Fly   265 KGIQLIHPVVHKCTNGLVHLLPGDDAYPADPDASNEKIEIDLSVEEFRSKTNAKLHRSEHWNQ 327
            |......|:.....|.:.:..|||..| .|.::..:.:. .:|.:..........||:.::::
 Worm   203 KKPICPQPIKTIGENLITNCFPGDYMY-IDENSLQQPLR-QMSADRVTVDPTQPTHRATYYSE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
ndx-7NP_491336.2 NUDIX 10..173 CDD:278710 52/226 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165826
Domainoid 1 1.000 59 1.000 Domainoid score I7060
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13211
Inparanoid 1 1.050 79 1.000 Inparanoid score I3805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm14788
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - LDO PTHR12318
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2673
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.