DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and C50F4.16

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_505461.1 Gene:C50F4.16 / 179337 WormBaseID:WBGene00008238 Length:450 Species:Caenorhabditis elegans


Alignment Length:279 Identity:47/279 - (16%)
Similarity:79/279 - (28%) Gaps:116/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLAL----RLTAIRETFEELGILLCRDSKSLTSTS 134
            :|:|:.:|..|..     |.:|. :|.::.|..|    |::...:....:.|||           
 Worm     2 TASKISDVSFVTD-----FVSKY-QKGMEMSYTLDGNSRVSEFNQKMSSVSILL----------- 49

  Fly   135 DYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDVWSLHEWSVWRTPSTFKKRFETAFFMTA 199
                             .|.:..|||                          ..::|..|.|..:
 Worm    50 -----------------FHRDLEQFL--------------------------LVRQFRPAIFTAS 71

  Fly   200 LEQEPRVH-IEPNEVKDSAWRSPLDY---LQASLRKELWLPPPQFYELSRCLNFSSLDNLRQFAA 260
            :...|..| .|.:::..|::.|...|   |.|.|..:..|.|                  |:.|:
 Worm    72 ISNSPENHGKEFDKIDWSSYDSETGYTIELCAGLIDKEGLSP------------------REIAS 118

  Fly   261 EREVKGIQLIHPVVHKCTNGLVHLLPGDDAYPADPDASNEKIEIDLSVEEFRSKTNAKLHRSEHW 325
            |.          |..:|            .|..|||.....|...:...:..|        ::|.
 Worm   119 EE----------VAEEC------------GYRVDPDDLIHVITFVVGAHQSGS--------AQHL 153

  Fly   326 NQHQSQLIIKFERDDGQVH 344
            ...:....:|.....|.||
 Worm   154 YYAEIDESMKISEGGGNVH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
C50F4.16NP_505461.1 ADPRase_NUDT5 44..216 CDD:239516 37/231 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.