DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and DCP2

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_689837.2 Gene:DCP2 / 167227 HGNCID:24452 Length:420 Species:Homo sapiens


Alignment Length:162 Identity:32/162 - (19%)
Similarity:53/162 - (32%) Gaps:45/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AKNQVEKSTSCDYNALLLTRTQKSTFMPESSVFPGGVCDASDSSPA--WLEHFQ-------RNEF 73
            ||..|||          |:||:   |.....:||       |.||.  |::|.|       .|..
Human   261 AKPTVEK----------LSRTK---FRHSQQLFP-------DGSPGDQWVKHRQPLQQKPYNNHS 305

  Fly    74 SAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLALRLTAIRETFEELGILLCRDS---KSLTSTSD 135
            ..:.|     :||....:......:....|:...|...::...::..::.|...   :.|....:
Human   306 EMSDL-----LKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFE 365

  Fly   136 YGAFYD--------QFDRAHWQHIVHNNASQF 159
            ..|.||        ..:.|..|.:..|...:|
Human   366 TDAVYDLPSSSEDQLLEHAEGQPVACNGHCKF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
DCP2NP_689837.2 DCP2 12..93 CDD:309943
Dcp2p 97..246 CDD:239644
Nudix box 129..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..266 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..344 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.