DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and NUDT5

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_054861.2 Gene:NUDT5 / 11164 HGNCID:8052 Length:219 Species:Homo sapiens


Alignment Length:201 Identity:45/201 - (22%)
Similarity:74/201 - (36%) Gaps:53/201 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 NASQFLELCKQLDVLPDVWSLHEWSVWRTPSTFKKRFETAFFMTALEQEPRVHIEPNEVKDSAWR 219
            |..|:: :.::| :....|...|.:.:..|:...:.:|:....|..||          ..|....
Human    12 NGKQYI-ISEEL-ISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQ----------TADGVAV 64

  Fly   220 SPLDYLQASLRKEL------WLPPPQFYELSRCLNFSS--LDN--------LRQFAAEREVKG-- 266
            .|:  ||.:|..|.      :.||...|    |:.|.:  :|:        ||:...|...||  
Human    65 IPV--LQRTLHYECIVLVKQFRPPMGGY----CIEFPAGLIDDGETPEAAALRELEEETGYKGDI 123

  Fly   267 -----IQLIHPVVHKCTNGLVHL----LPGDDAYPADP---DASNEKIE-IDLSVEEFRSKTNAK 318
                 ...:.|.:..||   :|:    :.||||..|.|   ....|.:| |.|...:...:.:| 
Human   124 AECSPAVCMDPGLSNCT---IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDA- 184

  Fly   319 LHRSEH 324
            |...||
Human   185 LVAEEH 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None