DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and CG42814

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001189301.1 Gene:CG42814 / 10178958 FlyBaseID:FBgn0261996 Length:237 Species:Drosophila melanogaster


Alignment Length:80 Identity:19/80 - (23%)
Similarity:30/80 - (37%) Gaps:19/80 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EFSAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLALRL---------------TAIRETFEELGI 121
            :|..|..:.: |..| .||:...:||.:...|.:.:.|               .|..|..||.|.
  Fly    84 QFRGAVYQGI-HSAG-SPDMSKGEADLEQFPPEVGVTLELCGGAVDKDKSLAEIAKEEVLEECGY 146

  Fly   122 LLCRDSKSLTSTSDY 136
            .:  .::||....||
  Fly   147 EV--PTESLQHVYDY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
CG42814NP_001189301.1 ADPRase_NUDT5 65..230 CDD:239516 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.