DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13084 and CG4066

DIOPT Version :9

Sequence 1:NP_609971.1 Gene:CG13084 / 35229 FlyBaseID:FBgn0032788 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_650174.1 Gene:CG4066 / 41493 FlyBaseID:FBgn0038011 Length:588 Species:Drosophila melanogaster


Alignment Length:293 Identity:81/293 - (27%)
Similarity:142/293 - (48%) Gaps:34/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DESIADLLKDNAKGVQAANVLLTRIAQVSEQTQVGLAEQKEALKALTLVEKLLAKLTVVLEVGS- 83
            :|.|..||.:||..:...|..|..::.::.:....|..|.|.|.|:.:.|:||...|..|.:.. 
  Fly   299 EEIILALLAENAGALDRFNTQLDAVSAINWKIDAELDNQAEYLDAIEVTEELLRNQTQELLLWEV 363

  Fly    84 ---HNLVATLENLSRQGEEYGNRTESELLELVRLQEGTKEILNVLEAKLDAYQRHVLHSSRNIDN 145
               ..:|.:.:||    :.:.||:...:.:|.||||..|:.:..|..||:..|..:|..::.:|:
  Fly   364 ELLRGVVTSFQNL----DIFANRSIEAVSDLTRLQEQNKDRVRNLVDKLNVTQGQILRRTKGLDD 424

  Fly   146 SIDGLAKLITRTVLPQLNGLKCTFDSLETSQINVEVELKNLAGVKELSENSNFKLNVLEHQLKQL 210
            .::.:.:|:...:.|::|.|:.:||:|..||||..:||||:..|:.|::.|..||:.|::||...
  Fly   425 RLNFVNQLLLGYIEPKVNSLEDSFDNLNKSQINSLIELKNVPEVRNLTKTSIRKLSFLDNQLALF 489

  Fly   211 NRTQEQRLDILIDAVKHLQPHSSWKVEAVLRELIISQKRIEL----------------------- 252
            |:|||.|...:...:|...|.:..::..:...|.|||||.:|                       
  Fly   490 NQTQENRYYSVEAVIKAWTPTNLKEINDLTHALSISQKRTDLAIAISGSAEYNTETYPTRFISYK 554

  Fly   253 GLEEC--SRQQPYPQ-YGHHDESYLPTYGAEVP 282
            |:|:.  ||:...|| .|..|.:...::....|
  Fly   555 GIEDINQSRKTRTPQILGAEDNALESSWNVVAP 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13084NP_609971.1 SMC_prok_B <23..>255 CDD:274008 72/258 (28%)
PRK10263 <260..>445 CDD:236669 5/24 (21%)
CG4066NP_650174.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.