DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and rppH

DIOPT Version :10

Sequence 1:NP_609970.4 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_417307.1 Gene:rppH / 947300 ECOCYCID:G7459 Length:176 Species:Escherichia coli


Alignment Length:69 Identity:16/69 - (23%)
Similarity:28/69 - (40%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DDGNNKDYKVLMLKRSD----ATAIALNQTVFP-GGLLDSGADESVAWLHYLEEFGVPQEALRRL 81
            |||...:..:::..|..    |.....:...|| ||:....:.|...:....||.|:.::.:|.|
E. coli     4 DDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRIL 68

  Fly    82 VLIR 85
            ...|
E. coli    69 ASTR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_609970.4 NUDIX_AcylCoAdiphos_Nudt19 13..254 CDD:467582 16/69 (23%)
rppHNP_417307.1 PRK00714 1..156 CDD:234820 16/69 (23%)

Return to query results.
Submit another query.