DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and NUDT12

DIOPT Version :10

Sequence 1:NP_609970.4 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_563919.1 Gene:NUDT12 / 837845 AraportID:AT1G12880 Length:203 Species:Arabidopsis thaliana


Alignment Length:201 Identity:45/201 - (22%)
Similarity:68/201 - (33%) Gaps:79/201 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DSGADESVAWLHYLEEFGVPQEALRRLVLIREDRPAILAPQGTGCYDRFFKRSRIWAREITLRLT 119
            |||.|    :::.||.          |::...:|..::.|:|.            |..:.|:...
plant    39 DSGVD----FVNKLEV----------LMVSSPNRHDLVFPKGG------------WEDDETVLEA 77

  Fly   120 AVRECFEEVGL--LL---------CRSRSQL--------DFGAVTCAQAVPDLESWQRRVHNKPA 165
            |.||..||.|:  :|         .||:|..        ..|.:...:...:||.|..| .|:..
plant    78 ASREAIEEAGVKGILRELPLGVWEFRSKSSTVEDECLGGCKGYMFALKVTEELEDWPER-KNRER 141

  Fly   166 EFLT------LCRELNVVPDLWALHEWSAWASPGF---------IRKGHETVFFMAFVDKQPELL 215
            .:||      |||           :||...|...|         :|...|||       .....|
plant   142 RWLTVKEALELCR-----------YEWMQRALEEFLRVMEDERRLRTEEETV-------HDSSKL 188

  Fly   216 EEPSEV 221
            ||.|::
plant   189 EEESQI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_609970.4 NUDIX_AcylCoAdiphos_Nudt19 13..254 CDD:467582 45/201 (22%)
NUDT12NP_563919.1 NUDIX_DIPP2_like_Nudt4 21..165 CDD:467551 36/163 (22%)

Return to query results.
Submit another query.