DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and nudt8

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_021337150.1 Gene:nudt8 / 791929 ZFINID:ZDB-GENE-061013-219 Length:298 Species:Danio rerio


Alignment Length:146 Identity:30/146 - (20%)
Similarity:46/146 - (31%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLMLKRSDATA--IALNQTVFPGGLLDSGADESVAWLHYLEEFGVPQEALRRLV---LIREDRPA 90
            ||:......||  .||:..|.|.|...          .:...:|:.|::...:.   :..|.|||
Zfish    80 VLLFAHRSLTASPSALSTIVSPEGCTG----------RHTHRWGLNQQSCVSISAGHVCAESRPA 134

  Fly    91 ILAPQGTGCYDRFFKRSRIWAREITLRLTAVRECFEEVGLLLCRSRSQLDFGAVTCAQAVPDLES 155
            :.|.|          |.|:.      |.....||...:....||...|.:...            
Zfish   135 VFAIQ----------RRRLH------RNAQFEECVSALNEARCRRSLQANAAL------------ 171

  Fly   156 WQRRVHNKPAEFLTLC 171
            ::|..|...|..:.||
Zfish   172 YERDTHRWAAVLVCLC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 30/146 (21%)
nudt8XP_021337150.1 CoAse 178..>264 CDD:239518 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.