DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and Nudt14

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_079675.1 Gene:Nudt14 / 66174 MGIID:1913424 Length:222 Species:Mus musculus


Alignment Length:241 Identity:51/241 - (21%)
Similarity:76/241 - (31%) Gaps:96/241 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LHYLEEFGVPQ-----------------EALRRLVLIREDRPAILAPQGTGCYDRFFKRSRIWAR 112
            |||.:: ||.:                 .:.|.|||:::.|||:.|    |..:|.|..|     
Mouse    23 LHYRQD-GVQKSWDFMKTHDSVTILMFNSSRRSLVLVKQFRPAVYA----GEVERHFPGS----- 77

  Fly   113 EITLRLTAVRECFEEVGLLLCRSRSQLDFGAVTCAQAVPDLESWQRRVHNKPAEFLTLCRELNVV 177
                 ||||.                         |..|  :..|:.:.......:.||..:...
Mouse    78 -----LTAVN-------------------------QDQP--QELQQALPGSAGVMVELCAGIVDQ 110

  Fly   178 PDLWALHEWS---AWASPGF------------------IRKGHETVFFMAFVDKQ----PELLEE 217
            |.| :|.|.:   ||...|:                  :....:|:|:....|.|    ...|.|
Mouse   111 PGL-SLEEAACKEAWEECGYRLVPTDLRRVATYMSGVGLTSSRQTMFYAEVTDAQRGGPGGGLAE 174

  Fly   218 PSEVKETLWLTPVELLRLAD-------LGNV----WFMPPQVYELS 252
            ..|:.|.:.|...:....||       ||.:    ||....|..||
Mouse   175 EGELIEVIHLNLDDAQAFADNPDIPKTLGVIYAISWFFSQVVPHLS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 42/213 (20%)
Nudt14NP_079675.1 TIGR00052 17..210 CDD:129162 46/229 (20%)
Nudix box 111..129 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.