powered by:
Protein Alignment CG10195 and nudt3b
DIOPT Version :9
Sequence 1: | NP_001260583.1 |
Gene: | CG10195 / 35228 |
FlyBaseID: | FBgn0032787 |
Length: | 361 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017211962.1 |
Gene: | nudt3b / 450013 |
ZFINID: | ZDB-GENE-041010-128 |
Length: | 187 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 35/65 - (53%) |
Gaps: | 6/65 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 NNKDYKVLMLKRSDATAIALNQTVFPGGLLDSGADESVAWLHYL-EEFGVPQEALRRLVLIREDR 88
|:.:.:||::..|... ::.:.|||.::...:.:||....: ||.|| :..|.|||.|.|:|
Zfish 28 NDTEQEVLLVSSSRHP----DKWIVPGGGMEPEEEPNVAAAREVCEEAGV-KGTLGRLVGIFENR 87
Fly 89 88
Zfish 88 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10195 | NP_001260583.1 |
NUDIX |
10..237 |
CDD:278710 |
20/65 (31%) |
nudt3b | XP_017211962.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.