DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and Aps

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster


Alignment Length:97 Identity:20/97 - (20%)
Similarity:38/97 - (39%) Gaps:20/97 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KRSRIW-------AREITLRLTAVRECFEEVGLL--------LCRSRSQLDFGAVTCAQAVPDLE 154
            :|..:|       ..|....:|||||..||.|::        :..:...:....|.......:|:
  Fly    41 RRPELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVFENNDHMHRTEVFVMNVTQELD 105

  Fly   155 SWQ-RRVHNKPAEFLTLCRELNVVPDLWALHE 185
            .|: .|...:..::.|:...|:.:    |||:
  Fly   106 EWEDSRSIGRKRQWFTIDDALSQL----ALHK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 20/97 (21%)
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.