DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and Datp

DIOPT Version :10

Sequence 1:NP_609970.4 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_723505.2 Gene:Datp / 318908 FlyBaseID:FBgn0287788 Length:142 Species:Drosophila melanogaster


Alignment Length:44 Identity:14/44 - (31%)
Similarity:21/44 - (47%) Gaps:5/44 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGGLLDSGADE-SVAWLHYLEEFGVPQEALRRLVLIREDRPAIL 92
            |.|.:|.|.|: :.|.....||.|..::.|    :|.:|.|..|
  Fly    34 PKGHVDPGEDDFTTALRETKEEAGYDEKDL----IIYKDTPLTL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_609970.4 NUDIX_AcylCoAdiphos_Nudt19 13..254 CDD:467582 14/44 (32%)
DatpNP_723505.2 NUDIX_Ap4A_Nudt2 1..135 CDD:467534 14/44 (32%)

Return to query results.
Submit another query.