DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and NUDT7

DIOPT Version :10

Sequence 1:NP_609970.4 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:226 Identity:47/226 - (20%)
Similarity:87/226 - (38%) Gaps:62/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LEEFGVPQEALRRLVLIREDRPAILAPQGTG------CYDRFFKRSRIWARE------ITLRLTA 120
            :...|:|:|.:|..:|  :|..|.|.....|      .|:::.....:.|:|      .|:|...
Human     1 MSRLGLPEEPVRNSLL--DDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEK 63

  Fly   121 VRECFEEVGLLLC-----RSRSQLDFGAVTCAQAVPDLESWQRRVHNKPAEFLTLCRELNVVPDL 180
            :|....||    |     |..:.:|..|....:|       |..|..:|.:...:|   .:||  
Human    64 LRRAPGEV----CFPGGKRDPTDMDDAATALREA-------QEEVGLRPHQVEVVC---CLVP-- 112

  Fly   181 WALHEWSAWASPGFIRKGHETVFFMAFVDKQPELLEEPSEVKETLWLTPVELLRLADLGNVWFMP 245
             .|.:.....:|           |:..:|...:....|:|||: ::|.|:          .:|:.
Human   113 -CLIDTDTLITP-----------FVGLIDHNFQAQPNPAEVKD-VFLVPL----------AYFLH 154

  Fly   246 PQVYE---LSRLMGIKAYQSLLEFAIKRSGL 273
            |||::   ::|| |.:....:.|:.....|:
Human   155 PQVHDQHYVTRL-GHRFINHIFEYTNPEDGV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_609970.4 NUDIX_AcylCoAdiphos_Nudt19 13..254 CDD:467582 42/205 (20%)
NUDT7NP_001099133.1 NUDIX_CoAse_Nudt7 38..195 CDD:467532 37/187 (20%)
Nudix box 77..98 5/27 (19%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.