DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and ndx-8

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_493372.1 Gene:ndx-8 / 190780 WormBaseID:WBGene00003585 Length:234 Species:Caenorhabditis elegans


Alignment Length:334 Identity:62/334 - (18%)
Similarity:102/334 - (30%) Gaps:137/334 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTK--WRTSASVILVSRDDGNNKDYKVLMLKRSDATAIALNQTVFPGGLLDSGADESVAWLHYLE 69
            |||  ....|.|:::..|||:.| .|||:..||........:..||||::|....::|       
 Worm    21 PTKSQGEQDAGVLILLHDDGSEK-LKVLLCVRSRQLRRHPGEVCFPGGMMDDEDGQNV------- 77

  Fly    70 EFGVPQEALRRLVLIREDRPAILAPQGTGCYDRFFKRSRIWAREITLRLTAVRECFEEVGLLLCR 134
                                                           |.||:||.:||||:    
 Worm    78 -----------------------------------------------RRTAIREAYEEVGV---- 91

  Fly   135 SRSQLDFGAVTCAQAVPDLESWQRRVHNKPAEFLTLCRELNVVPDLWALHEWSAWASPGF-IRKG 198
                                       |:..::|.|..                  .|.| .|.|
 Worm    92 ---------------------------NENDDYLVLGN------------------LPAFRARFG 111

  Fly   199 ---HETVFFMAFVDKQPELLEEPSEVKETLWLTPVELLRLADLGNVWFMPPQVY--------ELS 252
               |.||   |.:.:.|..:....||:...|:...:.|.  |..:..|:..:.|        |..
 Worm   112 VLIHPTV---ALLRRPPTFVLSIGEVESIFWIPLSQFLE--DTHHSTFLIDEFYMVHVFQFDEYP 171

  Fly   253 RLMGIKAYQSLLEFAIKRSGLGTTMFLPIGYNCQGSMVFVLPGD--DFYVPEPHLVHEIISFPGS 315
            ...|:.|...::      ..:|....|| .:|..|::..   .|  |.::....::..:..|  :
 Worm   172 TTYGVTALMCIV------VAIGLLGKLP-NFNLMGNLTI---SDMLDKHLDSIEIIRHVYEF--A 224

  Fly   316 EEEFRARSK 324
            ..:|..:||
 Worm   225 SRKFEPKSK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 42/230 (18%)
ndx-8NP_493372.1 CoAse 28..182 CDD:239518 48/262 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.