DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and ndx-7

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_491336.2 Gene:ndx-7 / 183413 WormBaseID:WBGene00003584 Length:295 Species:Caenorhabditis elegans


Alignment Length:337 Identity:84/337 - (24%)
Similarity:129/337 - (38%) Gaps:97/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TKWRTSASVILVSRDDGNNKDYKVLMLKRSDATAIALNQTVFPGGLLDSGADESVAWLHYLEEFG 72
            :.||::||:||..:     ...:||||||........|..|||||::|. .|..:.     :|| 
 Worm     8 SSWRSAASIILACK-----TTRRVLMLKRGTTAKFMPNTMVFPGGVVDK-TDAKLG-----DEF- 60

  Fly    73 VPQEALRRLVLIREDRPAILAPQGTGCYDRFFKRSRIWAREITLRLTAVRECFEEVGLLLCRSRS 137
                                                        |:.||||.|||.|:|..::  
 Worm    61 --------------------------------------------RIAAVRELFEESGVLSTKN-- 79

  Fly   138 QLDFGAVTCAQAVPDLESWQRRVHNKPAEFL----TLCRELNVVPDLWALHEWSAWASPGFIRKG 198
                |..|.|.. ||:.|.:..:.|..::|.    |:|.: |::       ||..:.:|....:.
 Worm    80 ----GWQTSANN-PDMTSLKADIVNDTSKFEQLSGTICAD-NLI-------EWDTFITPANYPRR 131

  Fly   199 HETVFFMAFVDKQPELLEEPSEVKETLWLTPVELLRLADLGNVWFMPPQVYELSRLMGIKAYQSL 263
            ..|.|::..||.:|.:....||:.|..|:.|.|.:..|..|.....|||||||:||..:|.:...
 Worm   132 FLTKFYLMLVDDEPAIDLCTSEMSEYNWIEPKECVDEAYAGKYALPPPQVYELTRLSQVKDWDLC 196

  Fly   264 LEFAIKRSGLGTTMFLPIGYNCQGSMVFVLPGDDFYVPEPHLVHEIISFPGSEEEFRARS----- 323
            .::...:..:.......||.|.   :....|||..|:.|..|          ::..|..|     
 Worm   197 EKYGNVKKPICPQPIKTIGENL---ITNCFPGDYMYIDENSL----------QQPLRQMSADRVT 248

  Fly   324 ----KHLHRYTY 331
                :..||.||
 Worm   249 VDPTQPTHRATY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 57/230 (25%)
ndx-7NP_491336.2 NUDIX 10..173 CDD:278710 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165828
Domainoid 1 1.000 59 1.000 Domainoid score I7060
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm14788
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - O PTHR12318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.