DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and DCP2

DIOPT Version :10

Sequence 1:NP_609970.4 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_689837.2 Gene:DCP2 / 167227 HGNCID:24452 Length:420 Species:Homo sapiens


Alignment Length:96 Identity:28/96 - (29%)
Similarity:39/96 - (40%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LLDSGAD-ESV--AWLHYLEEFGVP-------QEALRRLVLIREDRPAILAPQGTGCYDRFFKRS 107
            ||..|.| |.|  .|..|  :.|||       .|.|..::|::    ..||..|.|     |.:.
Human    76 LLPQGEDVEKVLDEWKEY--KMGVPTYGAIILDETLENVLLVQ----GYLAKSGWG-----FPKG 129

  Fly   108 RIWAREITLRLTAVRECFEEVGL----LLCR 134
            :: .:|......|.||.|||.|.    .:|:
Human   130 KV-NKEEAPHDCAAREVFEETGFDIKDYICK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_609970.4 NUDIX_AcylCoAdiphos_Nudt19 13..254 CDD:467582 28/96 (29%)
DCP2NP_689837.2 DCP2 12..93 CDD:428265 7/16 (44%)
NUDIX_Dcp2p_Nudt20 97..246 CDD:467540 19/73 (26%)
Nudix box 129..150 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..266
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.