DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10195 and Nudt19

DIOPT Version :9

Sequence 1:NP_001260583.1 Gene:CG10195 / 35228 FlyBaseID:FBgn0032787 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_149071.2 Gene:Nudt19 / 110959 MGIID:94203 Length:357 Species:Mus musculus


Alignment Length:364 Identity:103/364 - (28%)
Similarity:159/364 - (43%) Gaps:32/364 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASPTKWRTSASVILVSR-DDGNNKDYKVLMLKRSDATAIALNQTVFPGGLLDSGADESVAWL--- 65
            :|.:.||.:|:|:|.:. ...:...:::|:|:|:..........|||||:||: ||.|..|:   
Mouse     2 SSSSSWRRAATVMLAAGWTHSSPAGFRLLLLQRAQNQRFLPGAHVFPGGVLDA-ADSSPDWVRLF 65

  Fly    66 ---HYLEEFGVPQEALRRLV---LIREDRPAILAPQGTGCYDRFFKRSRIWAREITLRLTAVREC 124
               |....||:..|..|:..   |...|......|.                 ::.||:.|:||.
Mouse    66 APRHTPPRFGLGPEPPRQPPFPGLSHGDADPAALPD-----------------DVALRICAIREA 113

  Fly   125 FEEVGLLLCRSRSQLDFGAVTCAQAVP--DLESWQRRVHNKPAEFLTLCRELNVVPDLWALHEWS 187
            |||.|:||.|.|..............|  .|..|:.||.:.|..||.||..|:..||:||||:|.
Mouse   114 FEEAGVLLLRPRDAAPASQEPSQALSPPAGLAEWRSRVRSDPRCFLQLCAHLDCTPDIWALHDWG 178

  Fly   188 AWASP-GFIRKGHETVFFMAFVDKQPELLEEPSEVKETLWLTPVELLRLADLGNVWFMPPQVYEL 251
            .|.:| |...:..:|.||:..:...|.:..:.:||....||:|.|.........:|..|||.||:
Mouse   179 GWLTPYGRTIRRFDTTFFLCCLRDIPRVEPDVAEVVGYQWLSPSEATECFLSKEIWLAPPQFYEM 243

  Fly   252 SRLMGIKAYQSLLEFAIKRSGLGTTMFLPIGYNCQGSMVFVLPGDDFYVPEPHLVHEIISFPGSE 316
            .||....:..:|..|...|.......:|||........:.:||||:.||.:...:.:.:|.....
Mouse   244 RRLENFASLSALYRFCSDRPSEVPEKWLPIILLTSDGTIHLLPGDELYVKDSDFLEKNMSTDKKT 308

  Fly   317 EEFRARSKHLHRYT-YGPGVRNLELNIAPPNGHLKPLKF 354
            ||.....|.|:|.. :.|.|..:.:.:...|.|:.|..:
Mouse   309 EEIVKEGKVLNRVVIHSPYVYEIYMTLPSENKHVYPRNY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10195NP_001260583.1 NUDIX 10..237 CDD:278710 71/239 (30%)
Nudt19NP_149071.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..93 5/20 (25%)
Nudix box 97..118 9/37 (24%)
Microbody targeting signal. /evidence=ECO:0000255 355..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm42845
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - O PTHR12318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.