DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and maf-1

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001379484.1 Gene:maf-1 / 6418592 WormBaseID:WBGene00077521 Length:166 Species:Caenorhabditis elegans


Alignment Length:118 Identity:44/118 - (37%)
Similarity:66/118 - (55%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 SASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLK 433
            |.||:..|.:.||.:..         |.|:|:.|..::||:||::|.|..|..|::.||||||||
 Worm    13 SVSSSAGSGSPSPMSSF---------DHLSDEELAQISVRQLNQKLMGQDRNVVMQWKQKRRTLK 68

  Fly   434 NRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQR 486
            |||||.|||::|::.:.:||..|.:|...:..|          |:||.:...|
 Worm    69 NRGYALNCRARRVNNQVQLEADNMMLRNQIKTL----------REALSEAQMR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 36/88 (41%)
coiled coil 419..486 CDD:269866 27/66 (41%)
maf-1NP_001379484.1 bZIP_Maf 54..123 CDD:269845 28/68 (41%)
coiled coil 62..113 CDD:269845 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166704
Domainoid 1 1.000 69 1.000 Domainoid score I6283
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14170
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 1 1.000 - - X543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.