DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and mafa

DIOPT Version :10

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001027475.1 Gene:mafa / 613050 XenbaseID:XB-GENE-6086265 Length:289 Species:Xenopus tropicalis


Alignment Length:352 Identity:99/352 - (28%)
Similarity:134/352 - (38%) Gaps:138/352 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PGGVPSTPPETPPVVGSPTGSSSCPAQTYAHHYARTPGSSVSVSASAAAAAAASAGAASVSAGLS 208
            ||.:.|||..| |....|:..|.|         |.:||:...|:.|...||         :....
 Frog    47 PGSLSSTPIST-PCSSVPSSPSFC---------APSPGAQSGVNPSNPNAA---------NKPQL 92

  Fly   209 HDMMWLTN-SIRADQQPLDLRPLPYPGSQEEAEEWDRQRDYALQAAAAHHHHH--GQPLMQAQHH 270
            .|:.|::| ....:.:.|:|.|       |:|.|       ||.....|||||  |....:.|.:
 Frog    93 EDLYWMSNYQHHINPEALNLTP-------EDAVE-------ALIGNPHHHHHHHQGYDGFRGQQY 143

  Fly   271 PHGH---GGHPHQVMLQQSKYPHHHHHHFHNLELTPINMHSNSYGSASGALTPTCLPQVPSNGSG 332
            |...   .||.|||       .||||||.|:|.                                
 Frog   144 PGDEMAPSGHHHQV-------HHHHHHHNHHLR-------------------------------- 169

  Fly   333 SSGGGGGSGSGSGGPGSVGGGSCVITRAALQPCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCL 397
                                                                        |||..
 Frog   170 ------------------------------------------------------------LEDRF 174

  Fly   398 NDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQD 462
            :|:.|.:::|||||::|.|..:|||:||||||||||||||||:||.||:.|||.||.....|...
 Frog   175 SDEQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRYKRVQQRHILETEKCQLQSQ 239

  Fly   463 LHRLKLEYSRVCQERDALMQRLQRAAN 489
            :.:||.|.||:.:|||....:.::.|:
 Frog   240 VEQLKQEVSRLAKERDLYKDKYEKLAS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:427158 46/88 (52%)
coiled coil 419..486 CDD:269866 37/66 (56%)
mafaNP_001027475.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..87 13/44 (30%)
Maf_N 90..123 CDD:462456 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..164 17/44 (39%)
bZIP_Maf_large 196..265 CDD:269866 37/68 (54%)
coiled coil 196..265 CDD:269866 37/68 (54%)
Basic motif 201..226 20/24 (83%)
Leucine-zipper 229..250 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..289 0/1 (0%)

Return to query results.
Submit another query.