DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and mafk

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_005164260.1 Gene:mafk / 415133 ZFINID:ZDB-GENE-040624-9 Length:157 Species:Danio rerio


Alignment Length:127 Identity:51/127 - (40%)
Similarity:70/127 - (55%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 LNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQ 461
            |:||.|..::|||||:.|.|..:|:||||||:||||||||||.:||.||:.|:.|||:....|..
Zfish    27 LSDDELVAMSVRELNQHLRGLTKEDVVRLKQRRRTLKNRGYAASCRIKRVTQKEELERQKTELQH 91

  Fly   462 DLHRLKLEYSRVCQERDALMQRLQ-------RAANGGVGAGGAT-------AGGDSQSSPEF 509
            ::.:|..|.:.:..|.|||..:.:       ....|..|...||       :...|.||..|
Zfish    92 EVDKLARENASMRLELDALRAKYEALQCFARTVTRGPPGKVAATSVITIVKSANHSPSSAPF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 43/95 (45%)
coiled coil 419..486 CDD:269866 32/73 (44%)
mafkXP_005164260.1 bZIP_Maf_small 49..118 CDD:269865 32/68 (47%)
coiled coil 49..118 CDD:269865 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.