DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and mafgb

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_005169479.1 Gene:mafgb / 405877 ZFINID:ZDB-GENE-040426-2403 Length:234 Species:Danio rerio


Alignment Length:145 Identity:54/145 - (37%)
Similarity:83/145 - (57%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 RAALQPCRPLSASSTRSSNNMS-----PR----TCSGAYSNATLE---------DCLNDDMLTTL 405
            |:||.|  |::.::.|.:.::.     ||    |..|   |..|:         ..|.||.|.::
Zfish    36 RSALSP--PVTVTAARDALDLRGLAAVPRGMTTTNKG---NKALKVKREPGENGTSLTDDELVSM 95

  Fly   406 TVRELNKRLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEY 470
            :|||||:.|.|..:||:::|||:||||||||||.:||.||:.|:.|||:....|.|::.:|..|.
Zfish    96 SVRELNQHLRGLSKEEILQLKQRRRTLKNRGYAASCRVKRVTQKEELERQKAELQQEVEKLASEN 160

  Fly   471 SRVCQERDALMQRLQ 485
            :.:..|.|||..:.:
Zfish   161 ASMKVELDALRSKYE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 42/89 (47%)
coiled coil 419..486 CDD:269866 31/67 (46%)
mafgbXP_005169479.1 bZIP_Maf_small 109..178 CDD:269865 31/67 (46%)
coiled coil 109..178 CDD:269865 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.