DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and MAFA

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_963883.2 Gene:MAFA / 389692 HGNCID:23145 Length:353 Species:Homo sapiens


Alignment Length:419 Identity:114/419 - (27%)
Similarity:158/419 - (37%) Gaps:163/419 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PGGVPSTPPETPPVVGSPTGSSSCPAQTYAHHYARTPGSSVSVSASAAAAAAASAGAASVSAG-- 206
            ||.:.|||..| |....|:..|.|         |.:||:.....|.....::.:.||....:|  
Human    47 PGSLSSTPLST-PCSSVPSSPSFC---------APSPGTGGGGGAGGGGGSSQAGGAPGPPSGGP 101

  Fly   207 ----------LSHDMMWLTN-SIRADQQPLDLRPLPYPGSQEEAEEWDRQRDYALQAAAAHHHHH 260
                      ...|:.|::. ....:.:.|:|.|       |:|.|       ||..:..|..||
Human   102 GAVGGTSGKPALEDLYWMSGYQHHLNPEALNLTP-------EDAVE-------ALIGSGHHGAHH 152

  Fly   261 GQPLMQAQHHP--------------------------HGHGGHPHQVMLQQSKYPHHHHHHFHNL 299
            |      .|||                          |.||.| |......:.:.||||||.|  
Human   153 G------AHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAH-HAAHHHHAAHHHHHHHHHH-- 208

  Fly   300 ELTPINMHSNSYGSASGALTPTCLPQVPSNGSGSSGGGGGSGSGSGGPGSVGGGSCVITRAALQP 364
                                                ||.|.|.|:|                   
Human   209 ------------------------------------GGAGHGGGAG------------------- 218

  Fly   365 CRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQKR 429
                                    .:..||:..:||.|.:::|||||::|.|..:|||:||||||
Human   219 ------------------------HHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKR 259

  Fly   430 RTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQR-AANGGVG 493
            ||||||||||:||.||:.|||.||.....|...:.:||||..|:.:|||...::.:: |..||.|
Human   260 RTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPG 324

  Fly   494 -AGGA---------TAG-GDSQSSPEFYL 511
             ||||         .|| |.::.:.:|:|
Human   325 SAGGAGFPREPSPPQAGPGGAKGTADFFL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 47/88 (53%)
coiled coil 419..486 CDD:269866 37/66 (56%)
MAFANP_963883.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..108 17/70 (24%)
Maf_N 111..144 CDD:285569 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..219 18/123 (15%)
bZIP_Maf_large 249..317 CDD:269866 37/67 (55%)
coiled coil 249..317 CDD:269866 37/67 (55%)
Basic motif 254..279 20/24 (83%)
Leucine-zipper 282..303 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..353 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143688
Domainoid 1 1.000 102 1.000 Domainoid score I6831
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4313
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40561
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.