DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Maff

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006242091.2 Gene:Maff / 366960 RGDID:1309531 Length:262 Species:Rattus norvegicus


Alignment Length:160 Identity:59/160 - (36%)
Similarity:82/160 - (51%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 GPGSVGGGS---CVITRAALQPCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTV 407
            |...|||.:   .:...:|.....|||:.:.:....:|..|           ..|:|:.|..|:|
  Rat    87 GSSPVGGHTRPPALKAPSAKMSVDPLSSKALKVKRELSENT-----------PHLSDEALMGLSV 140

  Fly   408 RELNKRLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSR 472
            ||||:.|.|...|||.||||:||||||||||.:||.||:.|:.||:|....|.:::.:|..|.:.
  Rat   141 RELNRNLRGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAA 205

  Fly   473 VCQERDAL---MQRLQRAANGGVGAGGATA 499
            :..|.|||   .:.||..|.....|.|..|
  Rat   206 MRLELDALRGKCEALQGFARSVAAARGPAA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 44/91 (48%)
coiled coil 419..486 CDD:269866 33/69 (48%)
MaffXP_006242091.2 bZIP_Maf_small 153..221 CDD:269865 32/67 (48%)
coiled coil 153..221 CDD:269865 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.