DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Nrl

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001099506.1 Gene:Nrl / 290221 RGDID:1305197 Length:238 Species:Rattus norvegicus


Alignment Length:137 Identity:61/137 - (44%)
Similarity:80/137 - (58%) Gaps:2/137 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 LQPCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLK 426
            ||...|:|........:.||.. :|| .|..|.:..:|..|.:::|||||::|.||.|:|.:|||
  Rat   100 LQSQGPVSVEGPHGYYSGSPGE-TGA-PNVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLK 162

  Fly   427 QKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQRAANGG 491
            |:|||||||||||.||||||.||..||.....|...|..|:.|.:|:.:|||....|..|..:||
  Rat   163 QRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGG 227

  Fly   492 VGAGGAT 498
            .|:...|
  Rat   228 PGSDDHT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 46/88 (52%)
coiled coil 419..486 CDD:269866 36/66 (55%)
NrlNP_001099506.1 Maf_N 68..102 CDD:285569 1/1 (100%)
bZIP_Maf 133..224 CDD:281170 47/90 (52%)
coiled coil 155..224 CDD:269866 37/68 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337419
Domainoid 1 1.000 102 1.000 Domainoid score I6667
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4264
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44698
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.