DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Mafk

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_663706.2 Gene:Mafk / 246760 RGDID:628633 Length:156 Species:Rattus norvegicus


Alignment Length:114 Identity:50/114 - (43%)
Similarity:71/114 - (62%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 STRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLKNRG 436
            :|....|.:.:....|..||.:   |:||.|.:::|||||:.|.|..:|||.||||:||||||||
  Rat     2 TTNPKPNKTLKVKKEAGENAPV---LSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRG 63

  Fly   437 YAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQ 485
            ||.:||.||:.|:.|||:....|.|::.:|..|.|.:..|.|||..:.:
  Rat    64 YAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 45/89 (51%)
coiled coil 419..486 CDD:269866 34/67 (51%)
MafkNP_663706.2 bZIP_Maf_small 46..115 CDD:269865 34/67 (51%)
coiled coil 54..105 CDD:269865 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.