DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and MAFF

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001155044.1 Gene:MAFF / 23764 HGNCID:6780 Length:164 Species:Homo sapiens


Alignment Length:133 Identity:53/133 - (39%)
Similarity:73/133 - (54%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 PLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRT 431
            |||:.:.:....:|..|           ..|:|:.|..|:|||||:.|.|...|||.||||:|||
Human     5 PLSSKALKIKRELSENT-----------PHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRT 58

  Fly   432 LKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDAL---MQRLQRAANGGVG 493
            |||||||.:||.||:.|:.||:|....|.:::.:|..|.:.:..|.|||   .:.||..|.....
Human    59 LKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAA 123

  Fly   494 AGG 496
            |.|
Human   124 ARG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 44/91 (48%)
coiled coil 419..486 CDD:269866 33/69 (48%)
MAFFNP_001155044.1 bZIP_Maf 24..115 CDD:308642 43/90 (48%)
coiled coil 47..115 CDD:269865 32/67 (48%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 51..76 18/24 (75%)
PRK13729 78..>162 CDD:184281 15/49 (31%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..93 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143685
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.