DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Nrl

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001129546.1 Gene:Nrl / 18185 MGIID:102567 Length:237 Species:Mus musculus


Alignment Length:203 Identity:75/203 - (36%)
Similarity:99/203 - (48%) Gaps:18/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 GSASGALTPTCLPQVPSNGSGSSGG--GGGSGSGSG--------------GPGSVGGGSCVITRA 360
            |..:.:|..|....||.:.:.|..|  |||.....|              |...|.|.|......
Mouse    33 GVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVE 97

  Fly   361 ALQPCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRL 425
            .||...|:|........:.||.. :|| .:..|.:..:|..|.:::|||||::|.||.|:|.:||
Mouse    98 LLQNQGPVSMEGPLGYYSGSPGE-TGA-QHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRL 160

  Fly   426 KQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQRAANG 490
            ||:|||||||||||.||||||.||..||.....|...|..|:.|.:|:.:|||....|..|..:|
Mouse   161 KQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSG 225

  Fly   491 GVGAGGAT 498
            |.|:...|
Mouse   226 GPGSDDHT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 46/88 (52%)
coiled coil 419..486 CDD:269866 36/66 (55%)
NrlNP_001129546.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..64 10/30 (33%)
Minimal transactivation domain (MTD). /evidence=ECO:0000250|UniProtKB:P54845 30..93 15/59 (25%)
Maf_N 67..101 CDD:285569 6/33 (18%)
bZIP_Maf_large 154..223 CDD:269866 37/68 (54%)
coiled coil 154..223 CDD:269866 37/68 (54%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 159..185 22/25 (88%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 187..208 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833873
Domainoid 1 1.000 102 1.000 Domainoid score I6805
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.