DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Mafk

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_034887.1 Gene:Mafk / 17135 MGIID:99951 Length:156 Species:Mus musculus


Alignment Length:114 Identity:50/114 - (43%)
Similarity:71/114 - (62%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 STRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLKNRG 436
            :|....|.:.:....|..||.:   |:||.|.:::|||||:.|.|..:|||.||||:||||||||
Mouse     2 TTNPKPNKALKVKKEAGENAPV---LSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRG 63

  Fly   437 YAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQ 485
            ||.:||.||:.|:.|||:....|.|::.:|..|.|.:..|.|||..:.:
Mouse    64 YAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 45/89 (51%)
coiled coil 419..486 CDD:269866 34/67 (51%)
MafkNP_034887.1 bZIP_Maf_small 46..115 CDD:269865 34/67 (51%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 51..76 18/24 (75%)
coiled coil 54..105 CDD:269865 25/50 (50%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..93 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42632
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.