DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and Maff

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_036015105.1 Gene:Maff / 17133 MGIID:96910 Length:267 Species:Mus musculus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:106/270 - (39%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GQPLMQAQHHPHGHGGHPHQVMLQQSKYPHHHHHHFHNLELT---PINMHSNSYGSASGALTPTC 322
            ||...|..|.|...|.                 .|....|||   |.|..:         |.|  
Mouse    17 GQRQRQEGHGPRRRGS-----------------RHLPENELTTGSPKNTRN---------LRP-- 53

  Fly   323 LPQVPSNGSGSSGGGGGSGSGSGGPGSV--GGGS-----CVI------------------TRAAL 362
                   |.|.:|......|..||...|  .|||     ||:                  :.:|.
Mouse    54 -------GVGPAGFPRKKRSLEGGAPRVRQTGGSGLSLPCVLENWGLLLEAKSQRSPAQRSSSAK 111

  Fly   363 QPCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQ 427
            ....|||:.:.:....:|..|           ..|:|:.|..|:|||||:.|.|...|||.||||
Mouse   112 MAVDPLSSKALKVKRELSENT-----------PHLSDEALMGLSVRELNRNLRGLSAEEVTRLKQ 165

  Fly   428 KRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDAL---MQRLQRAAN 489
            :||||||||||.:||.||:.|:.||:|....|.:::.:|..|.:.:..|.|||   .:.||..|.
Mouse   166 RRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFAR 230

  Fly   490 GGVGAGGATA 499
            ....|.|..|
Mouse   231 SVAAARGPAA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 44/91 (48%)
coiled coil 419..486 CDD:269866 33/69 (48%)
MaffXP_036015105.1 bZIP_Maf_small 158..226 CDD:269865 32/67 (48%)
coiled coil 165..216 CDD:269865 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.