DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and maff

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_002934281.1 Gene:maff / 100488557 XenbaseID:XB-GENE-489964 Length:148 Species:Xenopus tropicalis


Alignment Length:93 Identity:48/93 - (51%)
Similarity:64/93 - (68%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 LNDDMLTTLTVRELNKRLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQ 461
            |:||.|.:::|||||..|.|..:||||||||:||||||||||.:||.||:.|:.||||..:.|.|
 Frog    24 LSDDELMSMSVRELNHHLRGLSKEEVVRLKQRRRTLKNRGYAASCRVKRVSQKEELEKQKKDLQQ 88

  Fly   462 DLHRLKLEYSRVCQERDALMQRLQRAAN 489
            ::.:|..|.|.:..|.|||..:.:...|
 Frog    89 EVEKLAQENSTIKLELDALRAKYEALQN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 47/88 (53%)
coiled coil 419..486 CDD:269866 36/66 (55%)
maffXP_002934281.1 bZIP_Maf_small 46..115 CDD:269865 36/68 (53%)
coiled coil 46..115 CDD:269865 36/68 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47736
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.