DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tj and mafk

DIOPT Version :9

Sequence 1:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_031748285.1 Gene:mafk / 100036635 XenbaseID:XB-GENE-959430 Length:173 Species:Xenopus tropicalis


Alignment Length:122 Identity:52/122 - (42%)
Similarity:74/122 - (60%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PCRPLSASSTRSSNNMSPRTCSGAYSNATLEDCLNDDMLTTLTVRELNKRLHGCPREEVVRLKQK 428
            |...|...:|....|.:.:....|..||.:   |:||.|.:::|||||:.|.|..:||::||||:
 Frog    11 PGNCLQVMTTNPKPNKALKVKKEAAENAPV---LSDDELVSMSVRELNQHLRGLTKEEIIRLKQR 72

  Fly   429 RRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRLKLEYSRVCQERDALMQRLQ 485
            ||||||||||.:||.||:.|:.||||....|.|::.:|..|.|.:..|.|||..:.:
 Frog    73 RRTLKNRGYAASCRVKRVTQKEELEKQRIELQQEVDKLARENSSMKLELDALRSKYE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 45/89 (51%)
coiled coil 419..486 CDD:269866 34/67 (51%)
mafkXP_031748285.1 bZIP_Maf_small 63..132 CDD:269865 34/67 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47736
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.