DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and SEC14

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:60/253 - (23%)
Similarity:110/253 - (43%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQN--- 97
            |...|:::|.:.:.|..:.:....:  |.|...|.:|||||.:.::.:.::..:..::|:..   
Yeast    27 GNLDSAQEKALAELRKLLEDAGFIE--RLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTD 89

  Fly    98 ---KSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFG---LWRPNQVTVDD------IF 150
               :.|:...:||..:...|....|     |:.|..:.....|   |...|:||.::      ::
Yeast    90 TILQDFHYDEKPLIAKFYPQYYHKT-----DKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVW 149

  Fly   151 RATIVLQELGSLEPISQIVG-----GVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSA 210
            ....|:|.  .|...|:..|     ...|.|||.:.:.....:. |..::...:.....|.|...
Yeast   150 EYESVVQY--RLPACSRAAGHLVETSCTIMDLKGISISSAYSVM-SYVREASYISQNYYPERMGK 211

  Fly   211 LHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD-MTSLHKHINPEHLPKRYGGLHE 267
            .:|:|..:.|:.||::|||||:.....|::|.||. ...|.|.|..|:||.::||..|
Yeast   212 FYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGKSE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 10/46 (22%)
SEC14 112..265 CDD:238099 42/167 (25%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 10/46 (22%)
SEC14 99..269 CDD:214706 45/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.