DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and SFH5

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:56/273 - (20%)
Similarity:114/273 - (41%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HKLN---ITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSD-AKYLEKFLRA 75
            :|||   :|:|||.::.             .:|:.::     |.:..|:.::.: :..::..:..
Yeast    36 YKLNPEGLTQEEVDKYY-------------DEKIADR-----LTYKLCKAYQFEYSTIVQNLIDI 82

  Fly    76 RYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFG-LW 139
            ..|:.|.: .|.|:           |::|...:|::||   |||.....|.:...:....:| |.
Yeast    83 LNWRREFN-PLSCA-----------YKEVHNTELQNVG---ILTFDANGDANKKAVTWNLYGQLV 132

  Fly   140 RPNQV--TVDDIFRATIVLQELG-SL--------EPISQI--VGGVGIF----DLKDLGLEHILH 187
            :..::  .||...|..|.|.|.| ||        ..::|:  ..||.::    |:|         
Yeast   133 KKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDNNYMTQVHDYKGVSVWRMDSDIK--------- 188

  Fly   188 LSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKH 252
               :.::.:|.:.....|....|.:.||...||...:.:.|.|::...|:| ::..:|.:.|.::
Yeast   189 ---NCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKK-FVVLTDGSKLGQY 249

  Fly   253 INPEHLP-KRYGG 264
            :  :..| :.|||
Yeast   250 L--KDCPYEGYGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 7/47 (15%)
SEC14 112..265 CDD:238099 39/172 (23%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.