DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and PATL1

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_177360.1 Gene:PATL1 / 843546 AraportID:AT1G72150 Length:573 Species:Arabidopsis thaliana


Alignment Length:286 Identity:63/286 - (22%)
Similarity:118/286 - (41%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GCRTMPTIEHKL-NITEEE---VPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDA 66
            |.:|:..||..: :::..|   .|..:..:|..:.| |...::|      .|......|..|||.
plant   200 GTKTVEAIEESIVSVSPPESAVAPVVVETVAVAEAE-PVEPEEV------SIWGVPLLQDERSDV 257

  Fly    67 KYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRI 131
             .|.||||||.:|::.:..:|.:..::|::|| ..|.|...:  .|.:.:.:......|:.||.:
plant   258 -ILTKFLRARDFKVKEALTMLKNTVQWRKENK-IDELVESGE--EVSEFEKMVFAHGVDKEGHVV 318

  Fly   132 LIYRFGLWRPNQVTVD-----DIFRATIVLQE-------LGSLEPISQIVGGVGIFDLKDLGLEH 184
            :...:|.::..::..|     ......|.|||       ..:.|..|..|......:...||...
plant   319 IYSSYGEFQNKELFSDKEKLNKFLSWRIQLQEKCVRAIDFSNPEAKSSFVFVSDFRNAPGLGKRA 383

  Fly   185 ILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNA-AMREKLYIHGSDMT- 247
            :...    .::.:.....:.|...:....:|..|.:...:|.|...:.: ..|.|:.:.|...: 
plant   384 LWQF----IRRAVKQFEDNYPEFAAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLAGPSKSA 444

  Fly   248 -SLHKHINPEHLPKRYGGLHEDYSYT 272
             ::.|:|.||.:|.:||||.:|...|
plant   445 DTIFKYIAPEQVPVKYGGLSKDTPLT 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 15/46 (33%)
SEC14 112..265 CDD:238099 30/167 (18%)
PATL1NP_177360.1 CRAL_TRIO_N <247..280 CDD:215024 13/33 (39%)
SEC14 297..463 CDD:238099 30/171 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182715at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.