DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and AT3G51670

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_190735.1 Gene:AT3G51670 / 824330 AraportID:AT3G51670 Length:409 Species:Arabidopsis thaliana


Alignment Length:219 Identity:57/219 - (26%)
Similarity:100/219 - (45%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPYR---DQHGHR 130
            |.||||||.:|:.:|.::|.....:||:.|:  ||:...||   |..|:.....|.   |:.||.
plant    85 LLKFLRARDFKVADSLRMLEK
CLEWREEFKA--EKLTEEDL---GFKDLEGKVAYMRGYDKEGHP 144

  Fly   131 ILIYRFGLWRPNQV---------TVDDIFRATIVLQELG----SLEPISQIVGGVG----IFDLK 178
            :....:|:::..::         .::...|..:.:.|.|    ..:|     |||.    :.|||
plant   145 VCYNAYGVFKEKEMYERVFGDEEKLNKFLRWRVQVLERGVKMLHFKP-----GGVNSIIQVTDLK 204

  Fly   179 DLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYI-- 241
            |:....:...|    .::::|...:.|...:....:|..|.|:..:.:|.|||....:.|..:  
plant   205 DMPKRELRVAS----NQILSLFQDNYPELVATKIFINVPWYFSVIYSMFSPFLTQRTKSKFVMSK 265

  Fly   242 HGSDMTSLHKHINPEHLPKRYGGL 265
            .|:...:|:|.|.||.:|.:||||
plant   266 EGNAAETLYKFIRPEDIPVQYGGL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 10/20 (50%)
SEC14 112..265 CDD:238099 38/174 (22%)
AT3G51670NP_190735.1 CRAL_TRIO_N 52..105 CDD:397711 10/19 (53%)
SEC14 127..288 CDD:214706 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1182715at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.