DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Ttpal

DIOPT Version :10

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_083788.2 Gene:Ttpal / 76080 MGIID:1923330 Length:343 Species:Mus musculus


Alignment Length:105 Identity:26/105 - (24%)
Similarity:45/105 - (42%) Gaps:12/105 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ARNP--EAQRAVQKKNLVVKQQTKPVEVIETKRNAQSKAACGIVNKPKILDI----DESDKDNHV 253
            |.||  :|:.||.....|:|:    :||||..:.. |..|..::.||...|:    :.|......
Mouse    28 AENPTYKAEDAVDLNWCVIKE----MEVIELNKRT-SGQAFEVILKPPSFDVAPELNTSMPQRKD 87

  Fly   254 AAVEYVDDMYSFYKEVEKESQPKMYMHIQTEMNEKMRAIL 293
            .::|.:.......:|..|..:.:|..|: .|..|..|.::
Mouse    88 PSLEEIQKKLEAAEERRKFQEAEMLKHL-AEKREHEREVI 126

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024
SEC14 117..265 CDD:469559 19/75 (25%)