DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Sec14l1

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:343 Identity:66/343 - (19%)
Similarity:134/343 - (39%) Gaps:97/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSSGCRTMPTI---EHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRS 64
            :|.|..:.|.:   :.||:      .::|:|..   |:....::..:.:.|.::.|.::.:..:.
Mouse   222 SSPGTASEPVVGTPDDKLD------ADYIKRYL---GDLTPLQESCLIRLRQWLQETHKGKIPKD 277

  Fly    65 DAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDIL-TVTP------ 122
            :  ::.:|||||.:.|:.:.:::|....:|:|::..|               || |.||      
Mouse   278 E--HILRFLRARDFNIDKAREIMCQSLTWRKQHQVDY---------------ILDTWTPPQVLLD 325

  Fly   123 -------YRDQHGHRILIYRFGLWRPNQVTVDDIFRA-----------TIVLQELGSLEPISQIV 169
                   :.|:.|..:.:.|.|     |:....:.||           :|..:.|...|..:::.
Mouse   326 YYAGGWHHHDKDGRPLYVLRLG-----QMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVF 385

  Fly   170 G-----GVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKP 229
            |     ...:.||:.|.:.|:.........::|.::..:.|.....|.|:....||...:.:..|
Mouse   386 GRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSP 450

  Fly   230 FLNAAMREKLYIH-GSD-------MTSLHKHINPEHL--------PKRYGGL------------- 265
            |::...|.|..|: |:|       :..:.|.|.|:.|        |:  |||             
Mouse   451 FIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPE--GGLVPKSLYRTAEELE 513

  Fly   266 HEDYSYTLWLDMLKEQCS 283
            :||..  ||.:.:.:..|
Mouse   514 NEDLK--LWTETIYQSAS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/46 (20%)
SEC14 112..265 CDD:238099 39/198 (20%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 61/320 (19%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 9/46 (20%)
CRAL_TRIO 326..490 CDD:279044 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.