DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and SEC14L6

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:298 Identity:66/298 - (22%)
Similarity:114/298 - (38%) Gaps:79/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFRE 95
            ::.:.|:...|::|.:.|||..|.:.....|:..| .:|.::|:||.:.::.|..:|..:..||:
Human     4 MSGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDD-YFLLRWLQARSFDLQKSEDMLRKHMEFRK 67

  Fly    96 QNKSFYEKVRPLDLRHVGQSDILTVTP------Y-------RDQHGHRILIYRFGLWRP------ 141
            |.          ||     ::||...|      |       .|..|..:..:..|...|      
Human    68 QQ----------DL-----ANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLS 117

  Fly   142 --NQVTVDDIFRATIVLQ---ELGSLEP-----------------------------------IS 166
              .|..:.|.||:..:|.   ||.|.:|                                   :.
Human   118 ASKQELLRDSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRGNCNTAIWPPMDRHKELGKRVE 182

  Fly   167 QIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFL 231
            :|   :.||.|:.|||..:......:.|:..:.|..:.|....:|.:|....:|..||.:.|.::
Human   183 KI---IAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYM 244

  Fly   232 NAAMREKLYIHGSD-MTSLHKHINPEHLPKRYGGLHED 268
            :...|.|:.|.|.: ...|.|.|:|:.||..:||...|
Human   245 SEETRRKVVILGDNWKQELTKFISPDQLPVEFGGTMTD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 13/46 (28%)
SEC14 112..265 CDD:238099 44/212 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.