DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and RLBP1

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:264 Identity:71/264 - (26%)
Similarity:133/264 - (50%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TMPTIEHKLNITEEEVPEHIRRLAQE--QGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEK 71
            |:...:.:||..||...|.:|.| ||  |.:..|.::..:.     :.|    :....|:.:..:
Human    53 TLQKAKDELNEREETREEAVREL-QEMVQAQAASGEELAVA-----VAE----RVQEKDSGFFLR 107

  Fly    72 FLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRF 136
            |:|||.:.:..:|:||..|..||.|....::.:.|..:|...::....|...||::|..::::..
Human   108 FIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNI 172

  Fly   137 GLWRPNQVTVDDIFRA-TIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALL 200
            ..|:..::|.|:|.:| ..:|::|...|. :||.|...|.:.|...::....|..|..:||:.:|
Human   173 ENWQSQEITFDEILQAYCFILEKLLENEE-TQINGFCIIENFKGFTMQQAASLRTSDLRKMVDML 236

  Fly   201 VTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGL 265
            ..|.|.|..|:|.::|.|.|...:.:.||||.:.:.|::::||.|::..::.|:...||..:||.
Human   237 QDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGT 301

  Fly   266 HEDY 269
            ...|
Human   302 LPKY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/46 (20%)
SEC14 112..265 CDD:238099 42/153 (27%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.