DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and ttpa

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_012820030.1 Gene:ttpa / 493547 XenbaseID:XB-GENE-953693 Length:285 Species:Xenopus tropicalis


Alignment Length:236 Identity:73/236 - (30%)
Similarity:128/236 - (54%) Gaps:22/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRP---LDLRHVGQSDILTVTPYRDQHGH 129
            :|.:|||||.:.||.::|||.:|:::|.:.......:||   |||...|...:|.   .||..|.
 Frog    51 FLLRFLRARDFCIELAFKLLKNY
HKWRAECPEITADLRPSPILDLFRAGYHAVLR---SRDDSGS 112

  Fly   130 RILIYRFGLWRPNQVTVDDIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQ 194
            ::||||...|.|...|..::||.:::..||...|..:|..|...||||:...|.|...::|::|:
 Frog   113 KVLIYRIEYWDPKLFTAYEVFRVSLITSELIVQEAETQRNGIKAIFDLQGWRLAHAFQITPTMAK 177

  Fly   195 KMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD-MTSLHKHINPEHL 258
            ::.|::..|.|::...:|::|:...|:..|.|.||||...:::::::|||: :.:|::|.:...|
 Frog   178 RIAAVMADSFPLKVRGVHLINEPLFFHPVFAIIKPFLPDKIKQRVHMHGSNYIPTLNQHFSTSIL 242

  Fly   259 PKRYGG-------LHEDYS--------YTLWLDMLKEQCSG 284
            |..|||       |.|:::        |.|.:...|:...|
 Frog   243 PPEYGGTGPAMSELCEEWTAHIMSSEDYLLSISQNKQFAEG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/21 (52%)
SEC14 112..265 CDD:238099 49/160 (31%)
ttpaXP_012820030.1 CRAL_TRIO_N 27..73 CDD:215024 11/21 (52%)
CRAL_TRIO 99..249 CDD:366224 48/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.