DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and CG11550

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:263 Identity:58/263 - (22%)
Similarity:110/263 - (41%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLE----KFLRARYWKIENSYKLLCSYY 91
            |..:....|..:...:.:|.::|    ..|||.|| ::.|    .|..|..:.:|.:.::|.:..
  Fly     6 LEDQYASFPEIRRPEVLKFLDWI----HAQPHISD-RFSEGEALHFFHACRYSMEVAKQVLDTNL 65

  Fly    92 RFREQNKSFYEKV---RPLDLRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFRAT 153
            ..|...:.|:..:   || ::|...::..:...|.....|:|:::.:......:.....|:.:..
  Fly    66 TARTHLEEFFVNLDCERP-EIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLY 129

  Fly   154 IVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNW 218
            .::.:....|...| .|.|.:.|||:..|.|:..:.....:|.:..|..:..||....|.:|...
  Fly   130 CMVFDFWMYEDGIQ-PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVP 193

  Fly   219 VFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHEDYS------YTLWLDM 277
            ..:....:..||:...:...|::| ||:...:|.:..|.|||.|||..|:.:      |...||.
  Fly   194 FMDKILALMTPFMKKELTTVLHMH-SDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLLDN 257

  Fly   278 LKE 280
            .||
  Fly   258 RKE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 12/50 (24%)
SEC14 112..265 CDD:238099 32/152 (21%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.