DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and CG10301

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:307 Identity:72/307 - (23%)
Similarity:128/307 - (41%) Gaps:60/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTIEHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPH---RSDAKYLEKF 72
            ||:   ..:.|:||.|...|:.|         |.:|  .|.:|.:    |||   |:|..:|..|
  Fly     7 PTL---AKLAEQEVNETPDRIQQ---------DIII--LRVWIRQ----QPHLRARTDVDFLIAF 53

  Fly    73 LRARYWKIENSYKLLCSYYR----FREQNKSFYEKVRPLDLRHVGQSDILTVTPYRD----QHGH 129
            ||...:.:|.:.:.:..|:.    |.|...:.....|.||:..:|      |..|.|    ....
  Fly    54 LRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQRLLDINRMG------VCLYPDMPKGDSRS 112

  Fly   130 RILIYRFGLWRPNQVTVDDIFRATIVLQELGSLE-PISQIVGGVGIFDLKDLGLEHILHLSPSVA 193
            .:.|.|||.:.||...:.:|:..:.:..|:.:|| ..:.:.|...|.||:.:..:.:......:.
  Fly   113 AMFIARFGHFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLF 177

  Fly   194 QKMIALLVTSMPIRTSALHIVN-----QNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHI 253
            :|....|....|::...::|:|     |..|. ..:.:....:|..:|   .:..|:  .|.:||
  Fly   178 RKWWNWLYNCSPLKVKEMYIINMPKDIQGTVM-FLYNVLSMQVNYPIR---VLKNSE--ELIEHI 236

  Fly   254 NPEHLPKRYGG----LHEDYSYTLWLDML-------KEQCSGNSIQK 289
            ..|.||:.|||    |.|..:|  ..|:|       ::.|:..:|::
  Fly   237 GKESLPEEYGGTNGHLGECVAY--MEDLLNSYRGYFEQDCNYGTIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 14/49 (29%)
SEC14 112..265 CDD:238099 37/166 (22%)
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 15/60 (25%)
CRAL_TRIO 114..248 CDD:279044 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.