DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and pinta

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:265 Identity:57/265 - (21%)
Similarity:118/265 - (44%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RRLAQEQGECPSSKDKVIEQFRNYILEH---NECQPHRSDAKYLEKFLRARYWKIENSYKLLCSY 90
            |::|...|: |......::...::::.:   |.|....:    |..|||...:.:|.:.|.|.::
  Fly    10 RQVATTDGD-PERVLAQVQDLSDWLVANPQINGCNTFEN----LHFFLRTSKFDVERAKKKLKTF 69

  Fly    91 YRFREQNKSFYEKVRP-----LDLRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIF 150
            |:.|.:...:::...|     .||..:|.  .|.:.|  |.....:::.|.....|...:.:::|
  Fly    70 YQMRAERTEWFDNRDPQLPEIQDLLKLGV--FLPIGP--DAEQRMVVVIRTAAHDPKLHSQNNVF 130

  Fly   151 RAT-IVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIV 214
            :.: ::|..|..|:|.:...|.|.|.|::.:.|.|.|.::|.:.::.:... |:.|.:...|...
  Fly   131 KTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESW-TAYPCQPKLLEFT 194

  Fly   215 NQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHEDYSY----TLWL 275
            |.....|.....|:.|:...:|.:|::. .:.||    ::.:.|||..||  :..||    ..|.
  Fly   195 NAPRHVNFFLNTFRIFMTPKIRSRLFVR-REGTS----VSCDQLPKELGG--QGLSYMELSVKWK 252

  Fly   276 DMLKE 280
            .:::|
  Fly   253 QLVEE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/49 (18%)
SEC14 112..265 CDD:238099 34/153 (22%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.