DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and CG10657

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster


Alignment Length:273 Identity:63/273 - (23%)
Similarity:123/273 - (45%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSG--------CRTMPTIEHKLNITEEEV--PEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNE 58
            |||        |...|.:  || :.:||:  .|:|||.|             :.|||.:|.:|..
  Fly    18 SSGGDYDYPYVCGLSPAM--KL-VAKEELHEDENIRRQA-------------LAQFREWIEKHPH 66

  Fly    59 CQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLD--LRHVGQSDILTVT 121
            .:..|:|..:|.:|||.:.:.:.::.::|..|...|:....:::::...|  :..:.::..|...
  Fly    67 IRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPL 131

  Fly   122 PYRDQHGHRILIYRFGLWRPNQVTVDDIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHIL 186
            |.||..|.:::......:.|.:.|...:.|...::.|....:..||:.|.|.|.|...:.:..:.
  Fly   132 PQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVS 196

  Fly   187 HLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHK 251
            ..|.:..:.::..:..|.|:|....|.||.....|...::....|:..:::::.:| .::..|..
  Fly   197 LWSLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKT 260

  Fly   252 HINPEHLPKRYGG 264
            .|:|..|||.|||
  Fly   261 KIDPAILPKEYGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 12/46 (26%)
SEC14 112..265 CDD:238099 34/153 (22%)
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 13/58 (22%)
CRAL_TRIO 126..274 CDD:279044 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.