DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and CG32407

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:264 Identity:57/264 - (21%)
Similarity:110/264 - (41%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSSKD---KVIEQFRNYILEHNECQP-----HRSDAK-------YLEKFLRARYWKIENSYKLLC 88
            ||.:|   :.|.|.:..||:..|.:|     |.:|.|       ::.|.|:...:.:|.....|.
  Fly     2 PSDQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLW 66

  Fly    89 SYYRFREQNKSF--YEKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTV----- 146
            ....:|   |||  |: :...:|.....:|.......:|:.|..:||          :|:     
  Fly    67 DNLAWR---KSFGVYD-ITEANLNQEFLNDGSIYVHNKDRDGKPLLI----------LTIKKHSK 117

  Fly   147 ----DDIFRATIV----LQELGSLEPISQIVGGVGIF-DLKDLGLEHILHLSPSVAQKMIALLVT 202
                :|:.|..:.    ||...:|:.|:       || |:...||.   :|.....:.:|.:..|
  Fly   118 SRNQEDLLRILVFWIERLQRDSNLDKIT-------IFMDMTGAGLS---NLDMGFIKSIIGVFET 172

  Fly   203 SMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHE 267
            ..|...:.:.:.:..::.:||||:.|.||.....:.|.:  :....:.::::.::..|.:|| ::
  Fly   173 KYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKV--TTKKDIDQYVDKDNCLKIWGG-ND 234

  Fly   268 DYSY 271
            ||.|
  Fly   235 DYVY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 14/61 (23%)
SEC14 112..265 CDD:238099 31/166 (19%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.