Sequence 1: | NP_609968.3 | Gene: | CG10026 / 35226 | FlyBaseID: | FBgn0032785 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025108.1 | Gene: | Sec14l3 / 380683 | MGIID: | 3617848 | Length: | 401 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 67/270 - (24%) |
---|---|---|---|
Similarity: | 105/270 - (38%) | Gaps: | 64/270 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 GECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQN--- 97
Fly 98 ---------------------------KSFYEKVRPLD----LRHVGQSDILTVTPYRDQHGHRI 131
Fly 132 LIYRFGLWRPNQVTVDDIFRATIVLQELG-SLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQK 195
Fly 196 MIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD--MTSLHKHINPEHL 258
Fly 259 PKRYGGLHED 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10026 | NP_609968.3 | CRAL_TRIO_N | 43..90 | CDD:215024 | 11/46 (24%) |
SEC14 | 112..265 | CDD:238099 | 45/155 (29%) | ||
Sec14l3 | NP_001025108.1 | CRAL_TRIO_N | 13..59 | CDD:215024 | 11/46 (24%) |
SEC14 | 76..246 | CDD:214706 | 51/195 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |