DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Sec14l3

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:105/270 - (38%) Gaps:64/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQN--- 97
            |:....:.:.:.:||..:.:.....|:..| .:|.::||||.:.::.|..:|..|..||:..   
Mouse     6 GDLSPKQAETLAKFRENVQDVLPALPNPDD-YFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDID 69

  Fly    98 ---------------------------KSFYEKVRPLD----LRHVGQSDILTVTPYRDQHGHRI 131
                                       ..:|:.:.|||    |..|.:.|:|. |..||  ..||
Mouse    70 HILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLK-TKMRD--CERI 131

  Fly   132 LIYRFGLWRPNQVTVDDIFRATIVLQELG-SLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQK 195
            |                 ....:..:.|| .:|.|      |.|||.:.|||:|.......|.|:
Mouse   132 L-----------------HECDLQTERLGRKIETI------VMIFDCEGLGLKHFWKPLVEVYQE 173

  Fly   196 MIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD--MTSLHKHINPEHL 258
            ...||..:.|.....:.||....:|...:.:.||||:...|.|:.:.||:  ...|.|.|:||.|
Mouse   174 FFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEEL 238

  Fly   259 PKRYGGLHED 268
            |..:||...|
Mouse   239 PAHFGGTLTD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 45/155 (29%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 11/46 (24%)
SEC14 76..246 CDD:214706 51/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.