DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Clvs2

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:234 Identity:52/234 - (22%)
Similarity:103/234 - (44%) Gaps:22/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCS 89
            ||.:.:...|..|.|.:..:.|::.|:.::...:....|:|..::.:|||||.:....:::||..
  Rat    10 PETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQ 74

  Fly    90 YYRFREQNKSFYEKVRPLD--LRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFRA 152
            |:.:|:||...::..:..|  ::...:..........|.:|.:||:.....|..::.|:.||.||
  Rat    75 YFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRA 139

  Fly   153 TIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQN 217
            .::..|....:|..|:.|.|.|.|..:...:....|:||    |:.|.:..:.:|      |...
  Rat   140 ILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPS----MLRLAIEGLQVR------VYHC 194

  Fly   218 WVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPE 256
            :.|..::.:|          .||:...|....:|...|:
  Rat   195 YCFFVSYMLF----------ALYVRILDNLWTNKTSKPK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 31/145 (21%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 11/45 (24%)
SEC14 103..>204 CDD:301714 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm9013
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.