DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Sec14l1

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:342 Identity:66/342 - (19%)
Similarity:133/342 - (38%) Gaps:95/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSSGCRTMPTI---EHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRS 64
            :|.|....|.:   :.||:      .::|:|..   |:....::..:.:.|.::.|.::.:..:.
  Rat   223 SSPGTVAEPVVGTPDDKLD------ADYIKRYL---GDLTPLQESCLIRLRQWLQETHKGKIPKD 278

  Fly    65 DAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTP------- 122
            :  ::.:|||||.:.|:.:.:::|....:|:|::..|    .||          |.||       
  Rat   279 E--HILRFLRARDFNIDKAREIMCQSLTWRKQHQVDY----ILD----------TWTPPQVLQDY 327

  Fly   123 ------YRDQHGHRILIYRFGLWRPNQVTVDDIFRA-----------TIVLQELGSLEPISQIVG 170
                  :.|:.|..:.:.|.|     |:....:.||           :|..:.|...|..:::.|
  Rat   328 YAGGWHHHDKDGRPLYVLRLG-----QMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFG 387

  Fly   171 -----GVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPF 230
                 ...:.||:.|.:.|:.........::|.::..:.|.....|.|:....||...:.:..||
  Rat   388 RPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPF 452

  Fly   231 LNAAMREKLYIH-GSD-------MTSLHKHINPEHL--------PKRYGGL-------------H 266
            ::...|.|..|: |:|       :..:.|.|.|:.|        |:  |||             :
  Rat   453 IDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPE--GGLVPKSLYRTPEELEN 515

  Fly   267 EDYSYTLWLDMLKEQCS 283
            ||..  ||.:.:.:..|
  Rat   516 EDLK--LWTETIYQSAS 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/46 (20%)
SEC14 112..265 CDD:238099 37/197 (19%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 9/46 (20%)
CRAL_TRIO 327..491 CDD:279044 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.